Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VPS54 Rabbit Polyclonal Antibody (HRP)

VPS54 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

WR, HCC8, SLP-8p, VPS54L, hVps54L, PPP1R164

UniProt

Q9P1Q0

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human VPS54

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FYLPQISKEHFTVYQQEISQREKIHERCKNICPPKDTFERTLLHTHDKSR

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

107kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_057600

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FTLP13 AAV Vector (Human) (CMV)
21034101 1 µg

FTLP13 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
OriCell™ Complete Medium For Rat Knee Articular Chondrocytes
RASKJ-90011 500 mL

OriCell™ Complete Medium For Rat Knee Articular Chondrocytes

Sign In for Pricing
View Details
DGKZ Rabbit Monoclonal Antibody
AMRe02971-01 1 Each

DGKZ Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
DGKZ Rabbit Monoclonal Antibody
AMRe02971-02 50 µL

DGKZ Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
DGKZ Rabbit Monoclonal Antibody
AMRe02971-03 100 µL

DGKZ Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
B430306N03Rik (NM_177083) Mouse Tagged ORF Clone
MG212864 10 µg

B430306N03Rik (NM_177083) Mouse Tagged ORF Clone

Sign In for Pricing
View Details