Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VPS54 Rabbit Polyclonal Antibody (HRP)

VPS54 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

WR, HCC8, SLP-8p, VPS54L, hVps54L, PPP1R164

UniProt

Q9P1Q0

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human VPS54

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FYLPQISKEHFTVYQQEISQREKIHERCKNICPPKDTFERTLLHTHDKSR

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

107kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_057600

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

pExpress-1-SNU13 Plasmid
PVT38150 2 µg

pExpress-1-SNU13 Plasmid

Sign In for Pricing
View Details
Doublecortin Rabbit Polyclonal Antibody (PerCP-Cy5.5)
orb1577899 100 µL

Doublecortin Rabbit Polyclonal Antibody (PerCP-Cy5.5)

Sign In for Pricing
View Details
Wilms Tumor Protein (WT1) (NM_024424) Human Tagged ORF Clone Lentiviral Particle
RC221271L4V 200 µL

Wilms Tumor Protein (WT1) (NM_024424) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Wbp11 (NM_021714) Mouse Tagged Lenti ORF Clone
MR220672L4 10 µg

Wbp11 (NM_021714) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Anti-Hu CD172a APC Mab (Clone : 15-414)
30-2888-100 100 Tests (T)

Anti-Hu CD172a APC Mab (Clone : 15-414)

Sign In for Pricing
View Details
Canine Coiled coil helix coiled coil helix domain containing protein 1 (CHCHD1) ELISA kit
GTR10428890 96 Well

Canine Coiled coil helix coiled coil helix domain containing protein 1 (CHCHD1) ELISA kit

Sign In for Pricing
View Details