Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPS6KA2 Rabbit Polyclonal Antibody (Biotin)

RPS6KA2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

RSK, HU-2, RSK3, p90RSK2, p90-RSK3, pp90RSK3, MAPKAPK1C, S6K-alpha, S6K-alpha2

UniProt

Q15349

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RPS6KA2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LSRQDVHLVKGAMAATYFALNRTPQAPRLEPVLSSNLAQRRGMKRLTSTR

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

81kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_066958

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

ASCL1 Antibody, HRP conjugated
CSB-PA002199LB01HU-01 50 µg

ASCL1 Antibody, HRP conjugated

Sign In for Pricing
View Details
ASCL1 Antibody, HRP conjugated
CSB-PA002199LB01HU-02 100 µg

ASCL1 Antibody, HRP conjugated

Sign In for Pricing
View Details
Chicken Formyl carbamyl Platelet Activating Factor ELISA kit
GTR10392677 96 Well

Chicken Formyl carbamyl Platelet Activating Factor ELISA kit

Sign In for Pricing
View Details
Pigeon Myosin Light Chain 6 (MYL6) ELISA Kit
MBS9373869 Inquire

Pigeon Myosin Light Chain 6 (MYL6) ELISA Kit

Sign In for Pricing
View Details
PathScan® Total Survivin Sandwich ELISA Kit
CST 7169V4 50 Kits

PathScan® Total Survivin Sandwich ELISA Kit

Sign In for Pricing
View Details
ACTL7B sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K0037508 1.0 µg DNA

ACTL7B sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details