Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPS6KA2 Rabbit Polyclonal Antibody (HRP)

RPS6KA2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RSK, HU-2, RSK3, p90RSK2, p90-RSK3, pp90RSK3, MAPKAPK1C, S6K-alpha, S6K-alpha2

UniProt

Q15349

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RPS6KA2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LSRQDVHLVKGAMAATYFALNRTPQAPRLEPVLSSNLAQRRGMKRLTSTR

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

81kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_066958

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ceruloplasmin polyclonal antibody
orb647037-01 50 μL

Ceruloplasmin polyclonal antibody

Sign In for Pricing
View Details
Ceruloplasmin polyclonal antibody
orb647037-02 100 µL

Ceruloplasmin polyclonal antibody

Sign In for Pricing
View Details
Ceruloplasmin polyclonal antibody
orb647037-03 200 µL

Ceruloplasmin polyclonal antibody

Sign In for Pricing
View Details
CRCP Protein Vector (Human) (pPM-C-His)
PV010628 500 ng

CRCP Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Rat Transient Receptor Potential Cation Channel Subfamily V Member 5 (TRPV5) ELISA Kit
MBS9919670-01 48 Well

Rat Transient Receptor Potential Cation Channel Subfamily V Member 5 (TRPV5) ELISA Kit

Sign In for Pricing
View Details
Rat Transient Receptor Potential Cation Channel Subfamily V Member 5 (TRPV5) ELISA Kit
MBS9919670-02 96 Well

Rat Transient Receptor Potential Cation Channel Subfamily V Member 5 (TRPV5) ELISA Kit

Sign In for Pricing
View Details