Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ODF2L Rabbit Polyclonal Antibody (HRP)

ODF2L Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

KIAA1229, MGC111060, RP5-977L11.1, dJ977L11.1

UniProt

A8MU56

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ODF2L

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KTVALKKASKVYKQRLDHFTGAIEKLTSQIRDQEAKLSETISASNAWKSH

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

60kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_001007023

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BAY 2965501
MBS5815272 Inquire

BAY 2965501

Sign In for Pricing
View Details
Fam164c sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K6651407 1.0 µg DNA

Fam164c sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Human PAX8 Ready-To-Use IHC Kit
orb3001787 50 Tests

Human PAX8 Ready-To-Use IHC Kit

Sign In for Pricing
View Details
Filamin C Gamma (FLNC) Magnetic Fluorescence Assay Kit
MBS2159997-01 96 Tests

Filamin C Gamma (FLNC) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Filamin C Gamma (FLNC) Magnetic Fluorescence Assay Kit
MBS2159997-02 5x 96 Tests

Filamin C Gamma (FLNC) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Filamin C Gamma (FLNC) Magnetic Fluorescence Assay Kit
MBS2159997-03 10x 96 Tests

Filamin C Gamma (FLNC) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details