Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GIMAP6 Rabbit Polyclonal Antibody (HRP)

GIMAP6 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

IAN2, IAN6, IAN-2, IAN-6

UniProt

Q6P9H5

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human GIMAP6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GVGVLGHTILVFTRKEDLAGGSLEDYVRETNNQALAWLDVTLARRHCGFN

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_078987

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HEXIM1 (hexamethylene bis-acetamide Inducible 1, CLP1, EDG1, FLJ13562, HIS1, MAQ1) (FITC)
247032-FITC 100 µL

HEXIM1 (hexamethylene bis-acetamide Inducible 1, CLP1, EDG1, FLJ13562, HIS1, MAQ1) (FITC)

Sign In for Pricing
View Details
Interleukin 17A (IL17A) Antibody
abx101190-01 100 µL

Interleukin 17A (IL17A) Antibody

Sign In for Pricing
View Details
Interleukin 17A (IL17A) Antibody
abx101190-02 200 µL

Interleukin 17A (IL17A) Antibody

Sign In for Pricing
View Details
Interleukin 17A (IL17A) Antibody
abx101190-03 1 mL

Interleukin 17A (IL17A) Antibody

Sign In for Pricing
View Details
Low Sample Volume Mouse Leptin Receptor (LEPR) ELISA Kit
abx575468-01 96 Tests

Low Sample Volume Mouse Leptin Receptor (LEPR) ELISA Kit

Sign In for Pricing
View Details
Low Sample Volume Mouse Leptin Receptor (LEPR) ELISA Kit
abx575468-02 5x 96 Tests

Low Sample Volume Mouse Leptin Receptor (LEPR) ELISA Kit

Sign In for Pricing
View Details