Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LOC100362453 Rabbit Polyclonal Antibody (Biotin)

LOC100362453 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: EVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

XP_002727970

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Colon
CS627789 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
Tmem205 Mouse Gene Knockout Kit (CRISPR)
KN517794 1 Kit

Tmem205 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
OR4M1 (C-term) Rabbit Polyclonal Antibody
AP53063PU-N 400 µL

OR4M1 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HIST4H4 Rabbit Polyclonal Antibody
AP20243PU-N 100 µg

HIST4H4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
C11ORF46 (ARL14EP) (C-term) Rabbit Polyclonal Antibody
AP50428PU-N 400 µL

C11ORF46 (ARL14EP) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Nexmif Mouse Gene Knockout Kit (CRISPR)
KN502387 1 Kit

Nexmif Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details