Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LOC100362453 Rabbit Polyclonal Antibody (FITC)

LOC100362453 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: EVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

XP_002727970

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Raptor Rabbit Monoclonal Antibody
E46F2441 40 µL

Raptor Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
GCHFR (NM_005258) Human Untagged Clone
SC116878 10 µg

GCHFR (NM_005258) Human Untagged Clone

Sign In for Pricing
View Details
Alg5 Mouse Gene Knockout Kit (CRISPR)
KN501140 1 Kit

Alg5 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Goose Niemann Pick Disease Type C2 ELISA Kit
MBS056194 Inquire

Goose Niemann Pick Disease Type C2 ELISA Kit

Sign In for Pricing
View Details
DUS1L Protein Vector (Human) (pPM-C-HA)
PV013219 500 ng

DUS1L Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Rabbit Myeloperoxidase (MPO) ELISA kit
CSB-E13689Rb-01 48 Tests

Rabbit Myeloperoxidase (MPO) ELISA kit

Sign In for Pricing
View Details