Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LOC100362453 Rabbit Polyclonal Antibody (FITC)

LOC100362453 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: EVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

XP_002727970

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GNL3 Recombinant Antibody, AbBy Fluor™ 750 Conjugated
bsm-61946R-BF750-TR 20 µL

GNL3 Recombinant Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
1700020C07Rik sgRNA CRISPR Lentivector (Mouse) (Target 2)
K3163903 1.0 µg DNA

1700020C07Rik sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Anti-Human PDGFB Antibody (SAA0449), FITC
MBS1582451-01 50 Tests

Anti-Human PDGFB Antibody (SAA0449), FITC

Sign In for Pricing
View Details
Anti-Human PDGFB Antibody (SAA0449), FITC
MBS1582451-02 100 Tests

Anti-Human PDGFB Antibody (SAA0449), FITC

Sign In for Pricing
View Details
Anti-Human PDGFB Antibody (SAA0449), FITC
MBS1582451-03 5x 100 Tests

Anti-Human PDGFB Antibody (SAA0449), FITC

Sign In for Pricing
View Details
RPSAP12 siRNA Oligos set (Human)
42663171 3x 5 nmol

RPSAP12 siRNA Oligos set (Human)

Sign In for Pricing
View Details