Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIAA1189 Rabbit Polyclonal Antibody (HRP)

KIAA1189 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

JN, KIAA1189

UniProt

Q8TAM6

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human KIAA1189

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RVIEFKKKHEEVSQFKEEGDASEDSPLSSASSQAVTPDEQPTLGKKSDIS

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Guinea pig, Human, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001009959

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Cdh16 activation kit by CRISPRa
GA200660 1 Kit

Mouse Cdh16 activation kit by CRISPRa

Sign In for Pricing
View Details
Myosin, Smooth Muscle Heavy Chain (MYH11/923 + SMMS-1), CF594 conjugate, 0.1mg/mL
BNC941136-100 1x 100 µL

Myosin, Smooth Muscle Heavy Chain (MYH11/923 + SMMS-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human PSIP1 activation kit by CRISPRa
GA107690 1 Kit

Human PSIP1 activation kit by CRISPRa

Sign In for Pricing
View Details
ARIH2 Rabbit Polyclonal Antibody
TA366301 100 µL

ARIH2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CNDP2 Mouse Monoclonal Antibody [Clone ID: AT15E5]
AM50023PU-N 100 µL

CNDP2 Mouse Monoclonal Antibody [Clone ID: AT15E5]

Sign In for Pricing
View Details
Recombinant Human NFYA Protein
PKSH032824-01 10 µg

Recombinant Human NFYA Protein

Sign In for Pricing
View Details