Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIAA1189 Rabbit Polyclonal Antibody (HRP)

KIAA1189 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

JN, KIAA1189

UniProt

Q8TAM6

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human KIAA1189

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RVIEFKKKHEEVSQFKEEGDASEDSPLSSASSQAVTPDEQPTLGKKSDIS

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Guinea pig, Human, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001009959

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-Butylidene Phthalide(Cis Trans mixture)
TRC-B692250-25G 25 g

3-Butylidene Phthalide(Cis Trans mixture)

Sign In for Pricing
View Details
Phospho-CDK1 (T161) Recombinant Rabbit monoclonal Antibody
HA750876 100 µL

Phospho-CDK1 (T161) Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Human S100A16 activation kit by CRISPRa
GA115373 1 Kit

Human S100A16 activation kit by CRISPRa

Sign In for Pricing
View Details
Disposable Cuvette Caps
S4100-5 500 Units/Pack

Disposable Cuvette Caps

Sign In for Pricing
View Details
Tissue Protein Lysate, Lung
CP565663 150 µg

Tissue Protein Lysate, Lung

Sign In for Pricing
View Details
MEK2 (MAP2K2) (NM_030662) Human Over-expression Lysate
LC403069 20 µg

MEK2 (MAP2K2) (NM_030662) Human Over-expression Lysate

Sign In for Pricing
View Details