Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Msn Rabbit Polyclonal Antibody (HRP)

Msn Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

C78546

UniProt

P26041

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SELANARDESKKTANDMIHAENMRLGRDKYKTLRQIRQGNTKQRIDEFES

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

63kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_034963

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-EBAG9 Antibody (R2T55)
RHA15501 100 μg

Anti-EBAG9 Antibody (R2T55)

Sign In for Pricing
View Details
HR-100A balance 102gx0.1mg ext cal
BAL8000 1 Each

HR-100A balance 102gx0.1mg ext cal

Sign In for Pricing
View Details
Anti-RIP2/RIPK2 Antibody Picoband® Fluoro550 Conjugated
PA1861-Fluoro550 100 µg/Vial

Anti-RIP2/RIPK2 Antibody Picoband® Fluoro550 Conjugated

Sign In for Pricing
View Details
COL6A3 discontinued
342637-01 100 µL

COL6A3 discontinued

Sign In for Pricing
View Details
COL6A3 discontinued
342637-02 200 µL

COL6A3 discontinued

Sign In for Pricing
View Details
PIK3CG (PIK3CG, Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform, Phosphatidylinositol 4,5-bisphosphate 3-kinase 110kD catalytic subunit gamma, Phosphoinositide-3-kinase catalytic gamma polypeptide, Serine/threonine protein k
MBS6334005-01 0.2 mL

PIK3CG (PIK3CG, Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform, Phosphatidylinositol 4,5-bisphosphate 3-kinase 110kD catalytic subunit gamma, Phosphoinositide-3-kinase catalytic gamma polypeptide, Serine/threonine protein k

Sign In for Pricing
View Details