Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C1orf190 Rabbit Polyclonal Antibody (FITC)

C1orf190 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

LRP35A, LRAP35a, C1orf190

UniProt

Q96LR2

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human C1orf190

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SIGSFLDTVAPSELDEQGPPGAPRSEMDWAKVIAGGERARTEVDVAATRL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Porcine, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_001013633

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lipase Inhibition Assay
TBS2122 100 Tests

Lipase Inhibition Assay

Sign In for Pricing
View Details
RBM15 sgRNA CRISPR Lentivector (Human) (Target 2)
K1793703 1.0 µg DNA

RBM15 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Human Glutathione S Transferase Mu 1 (GSTm1) ELISA Kit
MBS456077-01 48 Tests

Human Glutathione S Transferase Mu 1 (GSTm1) ELISA Kit

Sign In for Pricing
View Details
Human Glutathione S Transferase Mu 1 (GSTm1) ELISA Kit
MBS456077-02 96 Tests

Human Glutathione S Transferase Mu 1 (GSTm1) ELISA Kit

Sign In for Pricing
View Details
Human Glutathione S Transferase Mu 1 (GSTm1) ELISA Kit
MBS456077-03 5x 96 Tests

Human Glutathione S Transferase Mu 1 (GSTm1) ELISA Kit

Sign In for Pricing
View Details
Human Glutathione S Transferase Mu 1 (GSTm1) ELISA Kit
MBS456077-04 10x 96 Tests

Human Glutathione S Transferase Mu 1 (GSTm1) ELISA Kit

Sign In for Pricing
View Details