Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RTKN Rabbit Polyclonal Antibody (FITC)

RTKN Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q9BST9

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human RTKN

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: DSGPPAERSPCRGRVCISDLRIPLMWKDTEYFKNKGDLHRWAVFLLLQLG

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

63kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001015055

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-DCSTAMP Antibody (U.Rochester patent anti-DC-STAMP)
F1967-50 50 mg

Anti-DCSTAMP Antibody (U.Rochester patent anti-DC-STAMP)

Sign In for Pricing
View Details
Mouse Kinesin heavy chain isoform 5C, KIF5C ELISA Kit
MBS9330106-01 48 Well

Mouse Kinesin heavy chain isoform 5C, KIF5C ELISA Kit

Sign In for Pricing
View Details
Mouse Kinesin heavy chain isoform 5C, KIF5C ELISA Kit
MBS9330106-02 96 Well

Mouse Kinesin heavy chain isoform 5C, KIF5C ELISA Kit

Sign In for Pricing
View Details
Mouse Kinesin heavy chain isoform 5C, KIF5C ELISA Kit
MBS9330106-03 5x 96 Well

Mouse Kinesin heavy chain isoform 5C, KIF5C ELISA Kit

Sign In for Pricing
View Details
Mouse Kinesin heavy chain isoform 5C, KIF5C ELISA Kit
MBS9330106-04 10x 96 Well

Mouse Kinesin heavy chain isoform 5C, KIF5C ELISA Kit

Sign In for Pricing
View Details
HGD (Homogentisate 1,2-dioxygenase (Homogentisate Oxidase), AKU, HGO)
247058 100 µg

HGD (Homogentisate 1,2-dioxygenase (Homogentisate Oxidase), AKU, HGO)

Sign In for Pricing
View Details