Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RTKN Rabbit Polyclonal Antibody (HRP)

RTKN Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q9BST9

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human RTKN

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DSGPPAERSPCRGRVCISDLRIPLMWKDTEYFKNKGDLHRWAVFLLLQLG

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

63kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001015055

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Os07g0568300 Antibody
orb838790 2 mg

Os07g0568300 Antibody

Sign In for Pricing
View Details
Hamster Proteasome Subunit Alpha Type 7 ELISA Kit
MBS082448-01 48 Well

Hamster Proteasome Subunit Alpha Type 7 ELISA Kit

Sign In for Pricing
View Details
Hamster Proteasome Subunit Alpha Type 7 ELISA Kit
MBS082448-02 96 Well

Hamster Proteasome Subunit Alpha Type 7 ELISA Kit

Sign In for Pricing
View Details
Hamster Proteasome Subunit Alpha Type 7 ELISA Kit
MBS082448-03 5x 96 Well

Hamster Proteasome Subunit Alpha Type 7 ELISA Kit

Sign In for Pricing
View Details
Hamster Proteasome Subunit Alpha Type 7 ELISA Kit
MBS082448-04 10x 96 Well

Hamster Proteasome Subunit Alpha Type 7 ELISA Kit

Sign In for Pricing
View Details
TSPEAR shRNA (h) Lentiviral Particles
sc-91435-V 200 µL

TSPEAR shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details