Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GOPC Rabbit Polyclonal Antibody (Biotin)

GOPC Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CAL, FIG, PIST, GOPC1, dJ94G16.2

UniProt

Q9HD26

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human GOPC

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: RNDLKRPMQAPPGHDQDSLKKSQGVGPIRKVLLLKEDHEGLGISITGGKE

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

50kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001017408

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Oxidized Low Density Lipoprotein Antibody (OLAb) ELISA Kit
MBS3801598-01 48 Well

Human Oxidized Low Density Lipoprotein Antibody (OLAb) ELISA Kit

Sign In for Pricing
View Details
Human Oxidized Low Density Lipoprotein Antibody (OLAb) ELISA Kit
MBS3801598-02 96 Well

Human Oxidized Low Density Lipoprotein Antibody (OLAb) ELISA Kit

Sign In for Pricing
View Details
Human Oxidized Low Density Lipoprotein Antibody (OLAb) ELISA Kit
MBS3801598-03 5x 96 Well

Human Oxidized Low Density Lipoprotein Antibody (OLAb) ELISA Kit

Sign In for Pricing
View Details
Human Oxidized Low Density Lipoprotein Antibody (OLAb) ELISA Kit
MBS3801598-04 10x 96 Well

Human Oxidized Low Density Lipoprotein Antibody (OLAb) ELISA Kit

Sign In for Pricing
View Details
Distillation Apparatus, Simple
2080280/2 1 Each

Distillation Apparatus, Simple

Sign In for Pricing
View Details
Cyclin D3 (BSA & Azide Free) (CCNE 1, CCNE, Cyclin E1, Cyclin Es, Cyclin Et, G1/S specific cyclin E, CCND3) (Biotin)
MBS6266217-01 0.1 mL

Cyclin D3 (BSA & Azide Free) (CCNE 1, CCNE, Cyclin E1, Cyclin Es, Cyclin Et, G1/S specific cyclin E, CCND3) (Biotin)

Sign In for Pricing
View Details