Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ASPDH Rabbit Polyclonal Antibody (Biotin)

ASPDH Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

A6ND91

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human LOC554235

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VVEVAHPKIIHESGAQILRHANLLVGSPSALSDQTTERQLLEASQHWDHA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

31kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_001108070

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GOLGA7 (Golgin Subfamily A Member 7, Golgin A7, GOLGA7A, GOLGA3AP1, Golgi Complex-associated Protein of 16kD, GCP16, HDCKB03P, HSPC041, MGC4876, MGC21096) (APC)
127461-APC 100 µL

GOLGA7 (Golgin Subfamily A Member 7, Golgin A7, GOLGA7A, GOLGA3AP1, Golgi Complex-associated Protein of 16kD, GCP16, HDCKB03P, HSPC041, MGC4876, MGC21096) (APC)

Sign In for Pricing
View Details
Rabbit Polyclonal MICALL1 Antibody [mFluor Violet 500 SE]
NBP2-70017MFV500 0.1 mL

Rabbit Polyclonal MICALL1 Antibody [mFluor Violet 500 SE]

Sign In for Pricing
View Details
DSPE-PEG-Alkyne, 2K
LP096007-2K-01 1 g

DSPE-PEG-Alkyne, 2K

Sign In for Pricing
View Details
DSPE-PEG-Alkyne, 2K
LP096007-2K-02 5 g

DSPE-PEG-Alkyne, 2K

Sign In for Pricing
View Details
Mouse Arpc4 Pre-designed siRNA Set B
SI100982B 1 Each

Mouse Arpc4 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Igfbp6 Rat shRNA Plasmid (Locus ID 25641)
TL709699 1 Kit

Igfbp6 Rat shRNA Plasmid (Locus ID 25641)

Sign In for Pricing
View Details