Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SFRS7 Rabbit Polyclonal Antibody (HRP)

SFRS7 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

9G8, AAG3, SFRS7

UniProt

Q16629

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SFRS7

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MSRYGRYGGETKVYVGNLGTGAGKGELERAFSYYGPLRTVWIARNPPGFA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

27kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001026854

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Delta-like protein 4 (DLL4) ELISA Kit
RK10893 96 Tests

Human Delta-like protein 4 (DLL4) ELISA Kit

Sign In for Pricing
View Details
RAB3IL1 Antibody, FITC conjugated
A62947-100UG 100 µg

RAB3IL1 Antibody, FITC conjugated

Sign In for Pricing
View Details
S6+ Visible Scanning Spectro
SPE9204 1 Each

S6+ Visible Scanning Spectro

Sign In for Pricing
View Details
Fxr2 3'UTR Lenti-reporter-Luc Vector
21091084 1.0 µg

Fxr2 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Goat squamous cell carcinoma antigen (SCCAg) ELISA Kit
MBS265044-01 48 Well

Goat squamous cell carcinoma antigen (SCCAg) ELISA Kit

Sign In for Pricing
View Details
Goat squamous cell carcinoma antigen (SCCAg) ELISA Kit
MBS265044-02 96 Well

Goat squamous cell carcinoma antigen (SCCAg) ELISA Kit

Sign In for Pricing
View Details