Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PBLD Rabbit Polyclonal Antibody (HRP)

PBLD Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MAWBP, MAWDBP, HEL-S-306

UniProt

P30039

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PBLD

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KLPIFIADAFTARAFRGNPAAVCLLENELDEDMHQKIAREMNLSETAFIR

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

31kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_001028255

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HNRNPD (Heterogeneous Nuclear Ribonucleoprotein D0, Heterogeneous Nuclear Ribonucleoprotein D (AU-Rich Element RNA Binding Protein 1, 37kD)
482903 100 µL

HNRNPD (Heterogeneous Nuclear Ribonucleoprotein D0, Heterogeneous Nuclear Ribonucleoprotein D (AU-Rich Element RNA Binding Protein 1, 37kD)

Sign In for Pricing
View Details
Human Thyroid Stimulating Hormone Receptor (TSHR)(Sandwich ELISA) ELISA Kit
MBS2140303-01 24 Strip Well

Human Thyroid Stimulating Hormone Receptor (TSHR)(Sandwich ELISA) ELISA Kit

Sign In for Pricing
View Details
Human Thyroid Stimulating Hormone Receptor (TSHR)(Sandwich ELISA) ELISA Kit
MBS2140303-02 48 Well

Human Thyroid Stimulating Hormone Receptor (TSHR)(Sandwich ELISA) ELISA Kit

Sign In for Pricing
View Details
Human Thyroid Stimulating Hormone Receptor (TSHR)(Sandwich ELISA) ELISA Kit
MBS2140303-03 96 Well

Human Thyroid Stimulating Hormone Receptor (TSHR)(Sandwich ELISA) ELISA Kit

Sign In for Pricing
View Details
Human Thyroid Stimulating Hormone Receptor (TSHR)(Sandwich ELISA) ELISA Kit
MBS2140303-04 5x 96 Well

Human Thyroid Stimulating Hormone Receptor (TSHR)(Sandwich ELISA) ELISA Kit

Sign In for Pricing
View Details
Human Thyroid Stimulating Hormone Receptor (TSHR)(Sandwich ELISA) ELISA Kit
MBS2140303-05 10x 96 Well

Human Thyroid Stimulating Hormone Receptor (TSHR)(Sandwich ELISA) ELISA Kit

Sign In for Pricing
View Details