Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PAIP2 Rabbit Polyclonal Antibody (HRP)

PAIP2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PAIP-2, PAIP2A

UniProt

Q9BPZ3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MKDPSRSSTSPSIINEDVIINGHSHEDDNPFAEYMWMENEEEFNRQIEEE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

14kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_057564

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RRM2 (Ribonucleoside-diphosphate Reductase Subunit M2, Ribonucleotide Reductase Small Subunit, Ribonucleotide Reductase Small Chain, RR2) (HRP)
132850-HRP 100 µL

RRM2 (Ribonucleoside-diphosphate Reductase Subunit M2, Ribonucleotide Reductase Small Subunit, Ribonucleotide Reductase Small Chain, RR2) (HRP)

Sign In for Pricing
View Details
RUNDC2B Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV813401 1.0 µg DNA

RUNDC2B Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
LSM4 Human Over-expression Lysate
orb1377426 20 µg

LSM4 Human Over-expression Lysate

Sign In for Pricing
View Details
STAC, CT (STAC, SH3 and cysteine-rich domain-containing protein, Src homology 3 and cysteine-rich domain-containing protein) (APC) discontinued
042361-APC 200 µL

STAC, CT (STAC, SH3 and cysteine-rich domain-containing protein, Src homology 3 and cysteine-rich domain-containing protein) (APC) discontinued

Sign In for Pricing
View Details
SPP1 (Secreted Phosphoprotein 1, BNSP, BSPI, ETA-1, MGC110940, OPN) (MaxLight 650)
252060-ML650 100 µL

SPP1 (Secreted Phosphoprotein 1, BNSP, BSPI, ETA-1, MGC110940, OPN) (MaxLight 650)

Sign In for Pricing
View Details
BACH1 Knockout MES-OV Polyclonal Cells
ARG24300 1 Million

BACH1 Knockout MES-OV Polyclonal Cells

Sign In for Pricing
View Details