Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SAR1A Rabbit Polyclonal Antibody (FITC)

SAR1A Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

SAR1, Sara, SARA1, masra2

UniProt

Q9NR31

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of mouse SAR1A

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: AISEERLREMFGLYGQTTGKGSVSLKELNARPLGVFMCSVLKRQGYGEGF

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

21kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001136120.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ANGPTL6 (Angiopoietin Like Protein 6) CLIA Kit
E-CL-H0271-01 24 Tests

Human ANGPTL6 (Angiopoietin Like Protein 6) CLIA Kit

Sign In for Pricing
View Details
Human ANGPTL6 (Angiopoietin Like Protein 6) CLIA Kit
E-CL-H0271-02 48 Tests

Human ANGPTL6 (Angiopoietin Like Protein 6) CLIA Kit

Sign In for Pricing
View Details
Human ANGPTL6 (Angiopoietin Like Protein 6) CLIA Kit
E-CL-H0271-03 96 Tests

Human ANGPTL6 (Angiopoietin Like Protein 6) CLIA Kit

Sign In for Pricing
View Details
UBXN2B 3'UTR Luciferase Stable Cell Line
TU027744 1.0 mL

UBXN2B 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
1,3,5-Benzenetricarboxylic acid, 1,3-bis (1,1-dimethylethyl) ester
JH917980 1 Each

1,3,5-Benzenetricarboxylic acid, 1,3-bis (1,1-dimethylethyl) ester

Sign In for Pricing
View Details
RNF223 Antibody Blocking peptide
orb1451753 500 µg

RNF223 Antibody Blocking peptide

Sign In for Pricing
View Details