Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EXOC4 Rabbit Polyclonal Antibody (HRP)

EXOC4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SEC8, Sec8p, SEC8L1

UniProt

Q8TAR2

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human EXOC4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MAAEAAGGKYRSTVSKSKDPSGLLISVIRTLSTSDDVEDRENEKGRLEEA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001032203

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Maleimide Coated - 96 well plates - 8 Well Breakable Strips on single well holding frame - Black PS
MGB22F2-MAL 10x 96 Well Plates

Maleimide Coated - 96 well plates - 8 Well Breakable Strips on single well holding frame - Black PS

Sign In for Pricing
View Details
Human MMP-9 (Matrix Metalloproteinase 9) ELISA Kit
E-EL-H6075-01 24 Tests

Human MMP-9 (Matrix Metalloproteinase 9) ELISA Kit

Sign In for Pricing
View Details
Human MMP-9 (Matrix Metalloproteinase 9) ELISA Kit
E-EL-H6075-02 48 Tests

Human MMP-9 (Matrix Metalloproteinase 9) ELISA Kit

Sign In for Pricing
View Details
Human MMP-9 (Matrix Metalloproteinase 9) ELISA Kit
E-EL-H6075-03 96 Tests

Human MMP-9 (Matrix Metalloproteinase 9) ELISA Kit

Sign In for Pricing
View Details
Recombinant Mouse SerpinA8/AGT Protein (His Tag)
PKSM040726 100 µg

Recombinant Mouse SerpinA8/AGT Protein (His Tag)

Sign In for Pricing
View Details
CD28 (C28/76), CF568 conjugate, 0.1mg/mL
BNC680076-500 1x 500 µL

CD28 (C28/76), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details