Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EXOC4 Rabbit Polyclonal Antibody (HRP)

EXOC4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SEC8, Sec8p, SEC8L1

UniProt

Q96A65

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human EXOC4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TAIRTYQSITERITNSRNKIKQVKENLLSCKMLLHCKRDELRKLWIEGIE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001032203

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HLA-DQ (MHC II) (HLA-DQA1/2866R), CF568 conjugate, 0.1mg/mL
BNC682866-500 1x 500 µL

HLA-DQ (MHC II) (HLA-DQA1/2866R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human PSA Antibody Pair Set
E-KAB-0136 50 µL & 100 µg

Human PSA Antibody Pair Set

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon: sigmoid
CS509235 5x 5 µm

Frozen Tissue Sections, Colon: sigmoid

Sign In for Pricing
View Details
2’,3’-cGAMP succinimidyl ester
20334-AAT 100 µg

2’,3’-cGAMP succinimidyl ester

Sign In for Pricing
View Details
Sarcomeric Actinin Alpha 2 / ACTN2 (ACTN2/3292), CF568 conjugate, 0.1mg/mL
BNC683292-100 1x 100 µL

Sarcomeric Actinin Alpha 2 / ACTN2 (ACTN2/3292), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human MERTK/MER Protein (His Tag)
PKSH033481-01 10 µg

Recombinant Human MERTK/MER Protein (His Tag)

Sign In for Pricing
View Details