Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EXOC4 Rabbit Polyclonal Antibody (HRP)

EXOC4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SEC8, Sec8p, SEC8L1

UniProt

Q96A65

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human EXOC4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TAIRTYQSITERITNSRNKIKQVKENLLSCKMLLHCKRDELRKLWIEGIE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001032203

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Eosinophil Peroxidase (AHE-1), CF594 conjugate, 0.1mg/mL
BNC941231-500 1x 500 µL

Eosinophil Peroxidase (AHE-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
App Mouse Gene Knockout Kit (CRISPR)
KN501442 1 Kit

App Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Rnd3 Mouse Gene Knockout Kit (CRISPR)
KN514884 1 Kit

Rnd3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tssk6 Rabbit Polyclonal Antibody
TA363364 100 µL

Tssk6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FITC Conjugated Griffonia simplicifolia Lectin -GS-I-B4 -
F-2401-B-1 1 mg

FITC Conjugated Griffonia simplicifolia Lectin -GS-I-B4 -

Sign In for Pricing
View Details
Beta Actin Recombinant Mouse monoclonal Antibody
HA610019 100 µg

Beta Actin Recombinant Mouse monoclonal Antibody

Sign In for Pricing
View Details