Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pde4b Rabbit Polyclonal Antibody (FITC)

Pde4b Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Dpde, dunc, Dpde4, dunce, R74983

UniProt

Q9QXI7

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LVNKSIRQRRRFTVAHTCFDVENGPSPGRSPLDPQAGSSSGLVLHAAFPG

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

82kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_062814

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

SH3BGRL3 (NM_031286) Human Over-expression Lysate
LS083442-100ug 100 µg

SH3BGRL3 (NM_031286) Human Over-expression Lysate

Sign In for Pricing
View Details
Ska1 Mouse siRNA Oligo Duplex (Locus ID 66468)
SR407189 1 Kit

Ska1 Mouse siRNA Oligo Duplex (Locus ID 66468)

Sign In for Pricing
View Details
Porcine VEGF Co Regulated Chemokine 1 ELISA Kit
MBS088481-01 48 Well

Porcine VEGF Co Regulated Chemokine 1 ELISA Kit

Sign In for Pricing
View Details
Porcine VEGF Co Regulated Chemokine 1 ELISA Kit
MBS088481-02 96 Well

Porcine VEGF Co Regulated Chemokine 1 ELISA Kit

Sign In for Pricing
View Details
Porcine VEGF Co Regulated Chemokine 1 ELISA Kit
MBS088481-03 5x 96 Well

Porcine VEGF Co Regulated Chemokine 1 ELISA Kit

Sign In for Pricing
View Details
Porcine VEGF Co Regulated Chemokine 1 ELISA Kit
MBS088481-04 10x 96 Well

Porcine VEGF Co Regulated Chemokine 1 ELISA Kit

Sign In for Pricing
View Details