Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDE4B Rabbit Polyclonal Antibody (FITC)

PDE4B Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

DPDE4, PDEIVB

UniProt

Q5TEK5

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PDE4B

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: QDILDTLEDNRNWYQSMIPQSPSPPLDEQNRDCQGLMEKFQFELTLDEED

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

64kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001032416

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Thrombomodulin (TM) ELISA Kit
orb2980617 96 Tests

Rat Thrombomodulin (TM) ELISA Kit

Sign In for Pricing
View Details
PETE Antibody (Biotin)
orb685808-01 50 μL

PETE Antibody (Biotin)

Sign In for Pricing
View Details
PETE Antibody (Biotin)
orb685808-02 100 µL

PETE Antibody (Biotin)

Sign In for Pricing
View Details
Human Soluble Cluster of Differentiation 163 (sCD163) ELISA Kit
orb782732-01 48 Tests

Human Soluble Cluster of Differentiation 163 (sCD163) ELISA Kit

Sign In for Pricing
View Details
Human Soluble Cluster of Differentiation 163 (sCD163) ELISA Kit
orb782732-02 96 Tests

Human Soluble Cluster of Differentiation 163 (sCD163) ELISA Kit

Sign In for Pricing
View Details
Cdk20, ID (Cdk20, Ccrk, Cdch, Cyclin-dependent kinase 20, CDK-activating kinase p42, CDK-related protein kinase PNQLARE, Cell cycle-related kinase, Cell division protein kinase 20, Cyclin-dependent protein kinase H, Cyclin-kinase-activating kinase p42) (MaxLight 750) discontinued
033656-ML750 100 µL

Cdk20, ID (Cdk20, Ccrk, Cdch, Cyclin-dependent kinase 20, CDK-activating kinase p42, CDK-related protein kinase PNQLARE, Cell cycle-related kinase, Cell division protein kinase 20, Cyclin-dependent protein kinase H, Cyclin-kinase-activating kinase p42) (MaxLight 750) discontinued

Sign In for Pricing
View Details