Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARL17 Rabbit Polyclonal Antibody (Biotin)

ARL17 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ARL17, ARL17A

UniProt

Q8IVW1

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ARL17

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: KCSHVEFGMWKGGRSHPFLPHSSRCAGSGGQLDSILPHQSPAWGPWGCKD

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

19kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_001034172

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GOT2, NT (Glutamate Oxaloacetate Transaminase 2, Aspartate Aminotransferase Mitochondrial, Fatty Acid-binding Protein, FABP-1, FLJ40994, KAT4, KATIV, mAspAT, mitAAT, Plasma Membrane-associated Fatty Acid-binding Protein, FABPpm, Transaminase A)
MBS627800-01 0.2 mL

GOT2, NT (Glutamate Oxaloacetate Transaminase 2, Aspartate Aminotransferase Mitochondrial, Fatty Acid-binding Protein, FABP-1, FLJ40994, KAT4, KATIV, mAspAT, mitAAT, Plasma Membrane-associated Fatty Acid-binding Protein, FABPpm, Transaminase A)

Sign In for Pricing
View Details
GOT2, NT (Glutamate Oxaloacetate Transaminase 2, Aspartate Aminotransferase Mitochondrial, Fatty Acid-binding Protein, FABP-1, FLJ40994, KAT4, KATIV, mAspAT, mitAAT, Plasma Membrane-associated Fatty Acid-binding Protein, FABPpm, Transaminase A)
MBS627800-02 5x 0.2 mL

GOT2, NT (Glutamate Oxaloacetate Transaminase 2, Aspartate Aminotransferase Mitochondrial, Fatty Acid-binding Protein, FABP-1, FLJ40994, KAT4, KATIV, mAspAT, mitAAT, Plasma Membrane-associated Fatty Acid-binding Protein, FABPpm, Transaminase A)

Sign In for Pricing
View Details
Rabbit Monoclonal GFAP Antibody (ASTRO/1974R) [PerCP]
NBP3-08431PCP 100 µL

Rabbit Monoclonal GFAP Antibody (ASTRO/1974R) [PerCP]

Sign In for Pricing
View Details
APC_Cy7-Linked Monoclonal Antibody to Cluster Of Differentiation 73 (CD73)
MBS2163479-01 0.1 mL

APC_Cy7-Linked Monoclonal Antibody to Cluster Of Differentiation 73 (CD73)

Sign In for Pricing
View Details
APC_Cy7-Linked Monoclonal Antibody to Cluster Of Differentiation 73 (CD73)
MBS2163479-02 0.2 mL

APC_Cy7-Linked Monoclonal Antibody to Cluster Of Differentiation 73 (CD73)

Sign In for Pricing
View Details
APC_Cy7-Linked Monoclonal Antibody to Cluster Of Differentiation 73 (CD73)
MBS2163479-03 0.5 mL

APC_Cy7-Linked Monoclonal Antibody to Cluster Of Differentiation 73 (CD73)

Sign In for Pricing
View Details