Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UNC45A Rabbit Polyclonal Antibody (FITC)

UNC45A Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

SMAP1, SMAP-1, GCUNC45, UNC-45A, GC-UNC45, GCUNC-45, IRO039700

UniProt

A8K6F7

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human UNC45A

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: REIASTLMESEMMEILSVLAKGDHSPVTRAAAACLDKAVEYGLIQPNQDG

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

102kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_001034764

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APC-Linked Polyclonal Antibody to Lemur Tyrosine Kinase 3 (LMTK3)
MBS2120309-01 0.1 mL

APC-Linked Polyclonal Antibody to Lemur Tyrosine Kinase 3 (LMTK3)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Lemur Tyrosine Kinase 3 (LMTK3)
MBS2120309-02 0.2 mL

APC-Linked Polyclonal Antibody to Lemur Tyrosine Kinase 3 (LMTK3)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Lemur Tyrosine Kinase 3 (LMTK3)
MBS2120309-03 0.5 mL

APC-Linked Polyclonal Antibody to Lemur Tyrosine Kinase 3 (LMTK3)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Lemur Tyrosine Kinase 3 (LMTK3)
MBS2120309-04 1 mL

APC-Linked Polyclonal Antibody to Lemur Tyrosine Kinase 3 (LMTK3)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Lemur Tyrosine Kinase 3 (LMTK3)
MBS2120309-05 5 mL

APC-Linked Polyclonal Antibody to Lemur Tyrosine Kinase 3 (LMTK3)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Lemur Tyrosine Kinase 3 (LMTK3)
MBS2120309-06 5x 5 mL

APC-Linked Polyclonal Antibody to Lemur Tyrosine Kinase 3 (LMTK3)

Sign In for Pricing
View Details