Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACBD7 Rabbit Polyclonal Antibody (FITC)

ACBD7 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

BA455B2.2

UniProt

Q8N6N7

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human ACBD7

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: KQAIVGDINIACPGMLDLKGKAKWEAWNLKKGLSTEDATSAYISKAKELI

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

9kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001034933

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ANXA1 (Annexin A1, Annexin I, Annexin-1, Calpactin II, Calpactin-2, Chromobindin-9, Lipocortin I, Phospholipase A2 Inhibitory Protein, p35, ANX1, LPC1) (PE)
123350-PE 100 µL

ANXA1 (Annexin A1, Annexin I, Annexin-1, Calpactin II, Calpactin-2, Chromobindin-9, Lipocortin I, Phospholipase A2 Inhibitory Protein, p35, ANX1, LPC1) (PE)

Sign In for Pricing
View Details
CD30/TNFRSF8 Rabbit Polyclonal Antibody (HRP)
orb2573902 100 µg

CD30/TNFRSF8 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Rabbit Polyclonal NUP188 Antibody [CoraFluor 1]
NBP3-06066CL1 0.1 mL

Rabbit Polyclonal NUP188 Antibody [CoraFluor 1]

Sign In for Pricing
View Details
Human Influenza viruses B (FLU B) ELISA Kit
201-12-2058 96 Tests

Human Influenza viruses B (FLU B) ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Ska2 shRNA (UAS) - Lentiviral mouse Ska2 shRNA (UAS) plasmid
GTR15261691 1 Vial

Lentiviral mouse Ska2 shRNA (UAS) - Lentiviral mouse Ska2 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Mouse Monoclonal Pappalysin-1/PAPP-A Antibody (PAPP A 1-1) [DyLight 650]
NBP2-21614C 0.1 mL

Mouse Monoclonal Pappalysin-1/PAPP-A Antibody (PAPP A 1-1) [DyLight 650]

Sign In for Pricing
View Details