Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hmgcl Rabbit Polyclonal Antibody (FITC)

Hmgcl Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

P97519

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Hmgcl

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MGVSVVDSSVAGLGGCPYAKGASGNLATEDLVYMLTGLGIHTGVNLQKLL

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human

Tested Applications

WB

NCBI Accession Number

NP_077362

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human taurochenodeoxycholic acid (TCDCA) ELISA Kit
MBS7273400-01 48 Well

Human taurochenodeoxycholic acid (TCDCA) ELISA Kit

Sign In for Pricing
View Details
Human taurochenodeoxycholic acid (TCDCA) ELISA Kit
MBS7273400-02 96 Well

Human taurochenodeoxycholic acid (TCDCA) ELISA Kit

Sign In for Pricing
View Details
Human taurochenodeoxycholic acid (TCDCA) ELISA Kit
MBS7273400-03 5x 96 Well

Human taurochenodeoxycholic acid (TCDCA) ELISA Kit

Sign In for Pricing
View Details
Human taurochenodeoxycholic acid (TCDCA) ELISA Kit
MBS7273400-04 10x 96 Well

Human taurochenodeoxycholic acid (TCDCA) ELISA Kit

Sign In for Pricing
View Details
Fish Cadherin EGF LAG Seven Pass G-Type Receptor 2 ELISA Kit
MBS100294 Inquire

Fish Cadherin EGF LAG Seven Pass G-Type Receptor 2 ELISA Kit

Sign In for Pricing
View Details
COMMD1 (Copper Metabolism (Murr1) Domain Containing 1, C2orf5, MGC27155, MURR1)
244847 50 µg

COMMD1 (Copper Metabolism (Murr1) Domain Containing 1, C2orf5, MGC27155, MURR1)

Sign In for Pricing
View Details