Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SMAP1 Rabbit Polyclonal Antibody (FITC)

SMAP1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Rat

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MATRSCREKAQKLNEQHQLILSKLLREEDNKYCADCEAKGPRWASWNIGV

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

50kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

XP_002727223

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ROR-alpha/gamma Agonist
217752 10 mg

ROR-alpha/gamma Agonist

Sign In for Pricing
View Details
Recombinant Human CD218a/IL18R1 Protein, N-His
orb2967961-01 50 µg

Recombinant Human CD218a/IL18R1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human CD218a/IL18R1 Protein, N-His
orb2967961-02 100 µg

Recombinant Human CD218a/IL18R1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human CD218a/IL18R1 Protein, N-His
orb2967961-03 1 mg

Recombinant Human CD218a/IL18R1 Protein, N-His

Sign In for Pricing
View Details
Rdh10 (NM_181478) Rat Tagged Lenti ORF Clone
RR201146L4 10 µg

Rdh10 (NM_181478) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
SPI1, CT (SPI1, Transcription factor PU.1, 31kD-transforming protein) (Biotin) discontinued
042229-Biotin 200 µL

SPI1, CT (SPI1, Transcription factor PU.1, 31kD-transforming protein) (Biotin) discontinued

Sign In for Pricing
View Details