Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DBNDD2 Rabbit Polyclonal Antibody (Biotin)

DBNDD2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CK1BP, HSMNP1, C20orf35

UniProt

Q9BQY9

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human DBNDD2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: DPNPRAALERQQLRLRERQKFFEDILQPETEFVFPLSHLHLESQRPPIGS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

17kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Ifna2 shRNA (UAS) - Lentiviral mouse Ifna2 shRNA (UAS, RFP) (100)
GTR15195228 1 Vial

Lentiviral mouse Ifna2 shRNA (UAS) - Lentiviral mouse Ifna2 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
UNC5C Rabbit Polyclonal Antibody (PerCP)
orb2543814 100 µL

UNC5C Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details
Rabbit Anti-Human Histone H4 Polyclonal Antibody
PA85331HU-01 50 µg

Rabbit Anti-Human Histone H4 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human Histone H4 Polyclonal Antibody
PA85331HU-02 100 µg

Rabbit Anti-Human Histone H4 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human Histone H4 Polyclonal Antibody
PA85331HU-03 500 µg

Rabbit Anti-Human Histone H4 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human Histone H4 Polyclonal Antibody
PA85331HU-04 1 mg

Rabbit Anti-Human Histone H4 Polyclonal Antibody

Sign In for Pricing
View Details