Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MYO1C Rabbit Polyclonal Antibody (Biotin)

MYO1C Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

NMI, MMIb, myr2, MMI-beta

UniProt

O00159

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human MYO1C

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: NPVLEAFGNAKTLRNDNSSRFGKYMDVQFDFKGAPVGGHILSYLLEKSRV

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

118kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_203693

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RRP8 (NM_015324) Human Tagged ORF Clone Lentiviral Particle
RC200844L3V 200 µL

RRP8 (NM_015324) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Donkey Monocyte Chemotactic Protein 1/Monocyte Chemotactic and Activating Factor ELISA Kit
MBS075606 Inquire

Donkey Monocyte Chemotactic Protein 1/Monocyte Chemotactic and Activating Factor ELISA Kit

Sign In for Pricing
View Details
Vmn2r118 ORF Vector (Mouse) (pORF)
49747014 1.0 µg DNA

Vmn2r118 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Protein Tyrosine Phosphatase Receptor Type Z (PTPRZ) Antibody
abx131519-01 100 µL

Protein Tyrosine Phosphatase Receptor Type Z (PTPRZ) Antibody

Sign In for Pricing
View Details
Protein Tyrosine Phosphatase Receptor Type Z (PTPRZ) Antibody
abx131519-02 200 µL

Protein Tyrosine Phosphatase Receptor Type Z (PTPRZ) Antibody

Sign In for Pricing
View Details
Protein Tyrosine Phosphatase Receptor Type Z (PTPRZ) Antibody
abx131519-03 1 mL

Protein Tyrosine Phosphatase Receptor Type Z (PTPRZ) Antibody

Sign In for Pricing
View Details