Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSMA4 Rabbit Polyclonal Antibody (HRP)

PSMA4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HC9, PSC9, HsT17706

UniProt

Q567Q5

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PSMA4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PCEQLVTALCDIKQAYTQFGGKRPFGVSLLYIGWDKHYGFQLYQSDPSGN

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

21kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001096138

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SmartEIA Chlamydia IgM (ELISA Kit) [CE]
SK-CHM096 96 Tests

SmartEIA Chlamydia IgM (ELISA Kit) [CE]

Sign In for Pricing
View Details
PCAF (Acetyl Lys428) Rabbit Polyclonal Antibody
APRab06250-01 20 µL

PCAF (Acetyl Lys428) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PCAF (Acetyl Lys428) Rabbit Polyclonal Antibody
APRab06250-02 50 µL

PCAF (Acetyl Lys428) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PCAF (Acetyl Lys428) Rabbit Polyclonal Antibody
APRab06250-03 100 µL

PCAF (Acetyl Lys428) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PCAF (Acetyl Lys428) Rabbit Polyclonal Antibody
APRab06250-04 200 µL

PCAF (Acetyl Lys428) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
AF1Q (Protein AF1q, MLLT11, RP11-316M1.10) (MaxLight 650)
123039-ML650 100 µL

AF1Q (Protein AF1q, MLLT11, RP11-316M1.10) (MaxLight 650)

Sign In for Pricing
View Details