Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TBC1D14 Rabbit Polyclonal Antibody (HRP)

TBC1D14 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FLJ32400, KIAA1322

UniProt

Q9P2M4

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TBC1D14

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MTDGKLSTSTNGVAFMGILDGRPGNPLQNLQHVNLKAPRLLSAPEYGPKL

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

76kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_001106832

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal DUSP27/DUPD1 Antibody (OTI7E4) [Alexa Fluor 532]
NBP2-72503AF532 0.1 mL

Mouse Monoclonal DUSP27/DUPD1 Antibody (OTI7E4) [Alexa Fluor 532]

Sign In for Pricing
View Details
REG3G (NM_001008387) Human Tagged ORF Clone Lentiviral Particle
RC223733L4V 200 µL

REG3G (NM_001008387) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
DPP2 (DPP7) Rabbit Polyclonal Antibody
TA338099 100 µL

DPP2 (DPP7) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Pseudomonas mallei (FITC) discontinued
P9175-24-FITC 100 µL

Pseudomonas mallei (FITC) discontinued

Sign In for Pricing
View Details
LSM10 Polyclonal Antibody
MBS9236651-01 0.1 mL

LSM10 Polyclonal Antibody

Sign In for Pricing
View Details
LSM10 Polyclonal Antibody
MBS9236651-02 5x 0.1 mL

LSM10 Polyclonal Antibody

Sign In for Pricing
View Details