Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATP6V1B2 Rabbit Polyclonal Antibody (HRP)

ATP6V1B2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DOOD, HO57, VATB, VPP3, Vma2, ZLS2, ATP6B2, ATP6B1B2

UniProt

P21281

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ATP6V1B2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NFIAQGPYENRTVFETLDIGWQLLRIFPKEMLKRIPQSTLSEFYPRDSAK

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001684

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Collagen Type I (5D8) Antibody
250274 0.2 mg

Collagen Type I (5D8) Antibody

Sign In for Pricing
View Details
CNRIP1 Lentiviral Activation Particles (m2)
sc-436193-LAC-2 200 µL

CNRIP1 Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
Hipk4, CT (Hipk4, Gm162, Homeodomain-interacting protein kinase 4) (MaxLight 550) discontinued
036571-ML550 100 µL

Hipk4, CT (Hipk4, Gm162, Homeodomain-interacting protein kinase 4) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Prostate Specific Acid Phosphatase (PSAP) (rACPP/1338), CF594 conjugate, 0.1mg/mL
BNC942074-100 1x 100 µL

Prostate Specific Acid Phosphatase (PSAP) (rACPP/1338), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SLC12A3 siRNA Oligos set (Human)
43872171 3x 5 nmol

SLC12A3 siRNA Oligos set (Human)

Sign In for Pricing
View Details
CPO Rabbit Polyclonal Antibody
TA420555 100 µg

CPO Rabbit Polyclonal Antibody

Sign In for Pricing
View Details