Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MARK3 Rabbit Polyclonal Antibody (FITC)

MARK3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

KP78, VIPB, CTAK1, PAR1A, Par-1a

UniProt

P27448

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MARK3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ATYNGPPASPSLSHEATPLSQTRSRGSTNLFSKLTSKLTRSRNVSAEQKD

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

81kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_002367

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human anti-Bullous Pemphigoid 180 antibody, BP180-Ab ELISA KIT
ED0493Hu 96 Well

Human anti-Bullous Pemphigoid 180 antibody, BP180-Ab ELISA KIT

Sign In for Pricing
View Details
Mouse IgG protein
orb1289514-01 1 mg

Mouse IgG protein

Sign In for Pricing
View Details
Mouse IgG protein
orb1289514-02 10 mg

Mouse IgG protein

Sign In for Pricing
View Details
ANKRD18A Knockout Hela Polyclonal Cells
ARG37503 1 Million

ANKRD18A Knockout Hela Polyclonal Cells

Sign In for Pricing
View Details
NELL2 (Protein Kinase C-binding Protein NELL2, NEL-like Protein 2, Nel-related Protein 2, NRP2) (PE)
138174-PE 100 µL

NELL2 (Protein Kinase C-binding Protein NELL2, NEL-like Protein 2, Nel-related Protein 2, NRP2) (PE)

Sign In for Pricing
View Details
COL18A1 Antibody, FITC conjugated
CSB-PA005725LC01HU-01 50 μL

COL18A1 Antibody, FITC conjugated

Sign In for Pricing
View Details