Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MYD88 Rabbit Polyclonal Antibody (HRP)

MYD88 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

IMD68, MYD88D

UniProt

Q99836

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MYD88

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGAHQKR

Field of Research

Infectious Disease & Virology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_002459

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

CYP1A2 Recombinant Antibody, PE-Cy7 Conjugated
bsm-61730R-PE-Cy7-01 20 µL

CYP1A2 Recombinant Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details
CYP1A2 Recombinant Antibody, PE-Cy7 Conjugated
bsm-61730R-PE-Cy7-02 100 µL

CYP1A2 Recombinant Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details
MSR1, CT (MSR1, SCARA1, Macrophage scavenger receptor types I and II, Macrophage acetylated LDL receptor I and II, Scavenger receptor class A member 1, CD204) (AP) discontinued
038638-AP 200 µL

MSR1, CT (MSR1, SCARA1, Macrophage scavenger receptor types I and II, Macrophage acetylated LDL receptor I and II, Scavenger receptor class A member 1, CD204) (AP) discontinued

Sign In for Pricing
View Details
Lentiviral mouse Car2 shRNA (UAS) - Lentiviral mouse Car2 shRNA (UAS, iRFP) (25)
GTR15268598 1 Vial

Lentiviral mouse Car2 shRNA (UAS) - Lentiviral mouse Car2 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
β-1,4-Gal-T5 Antibody
OM636485-01 100 µL

β-1,4-Gal-T5 Antibody

Sign In for Pricing
View Details
β-1,4-Gal-T5 Antibody
OM636485-02 20 µL

β-1,4-Gal-T5 Antibody

Sign In for Pricing
View Details