Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OAZ2 Rabbit Polyclonal Antibody (HRP)

OAZ2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AZ2

UniProt

O95190

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human OAZ2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PDGLLADGSKEGLLALLEFAEEKMKVNYVFICFRKGREDRAPLLKTFSFL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

21kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_002528

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

BOB1 Polyclonal Antibody, PE-Cy7 Conjugated
bs-12876R-PE-Cy7 100 µL

BOB1 Polyclonal Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details
Coenzyme A, Sodium Salt, Hydrate (CoA, CoASH, HSCoA) 98+% discontinued. See C7505-50A
236937-01 25 mg

Coenzyme A, Sodium Salt, Hydrate (CoA, CoASH, HSCoA) 98+% discontinued. See C7505-50A

Sign In for Pricing
View Details
Coenzyme A, Sodium Salt, Hydrate (CoA, CoASH, HSCoA) 98+% discontinued. See C7505-50A
236937-02 100 mg

Coenzyme A, Sodium Salt, Hydrate (CoA, CoASH, HSCoA) 98+% discontinued. See C7505-50A

Sign In for Pricing
View Details
Coenzyme A, Sodium Salt, Hydrate (CoA, CoASH, HSCoA) 98+% discontinued. See C7505-50A
236937-03 250 mg

Coenzyme A, Sodium Salt, Hydrate (CoA, CoASH, HSCoA) 98+% discontinued. See C7505-50A

Sign In for Pricing
View Details
Coenzyme A, Sodium Salt, Hydrate (CoA, CoASH, HSCoA) 98+% discontinued. See C7505-50A
236937-04 1 g

Coenzyme A, Sodium Salt, Hydrate (CoA, CoASH, HSCoA) 98+% discontinued. See C7505-50A

Sign In for Pricing
View Details
TRAX Rabbit Polyclonal Antibody (PerCP)
orb2497461 100 µL

TRAX Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details