Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pde2a Rabbit Polyclonal Antibody (Biotin)

Pde2a Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Pde2, Pde2a2, CGS-PDE

UniProt

Q01062

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Rat

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: CRSQQYPAARPAEPRGQQVFLKPDEPPPQPCADSLQDALLSLGAVIDIAG

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

104kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_001137319

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Signal transducer and activator of transcription 5B
orb1636059-01 50 µg

Signal transducer and activator of transcription 5B

Sign In for Pricing
View Details
Signal transducer and activator of transcription 5B
orb1636059-02 100 µg

Signal transducer and activator of transcription 5B

Sign In for Pricing
View Details
Signal transducer and activator of transcription 5B
orb1636059-03 1 mg

Signal transducer and activator of transcription 5B

Sign In for Pricing
View Details
Gm3336 (NM_001195253) Mouse Untagged Clone
MC215552 10 µg

Gm3336 (NM_001195253) Mouse Untagged Clone

Sign In for Pricing
View Details
Mouse Monoclonal alpha Adducin Antibody (5D4H1)
NBP2-52409 0.1 mg

Mouse Monoclonal alpha Adducin Antibody (5D4H1)

Sign In for Pricing
View Details
Lentiviral human MTRNR2L1 shRNA (UAS) - Lentiviral human MTRNR2L1 shRNA (UAS, iRFP) (25)
GTR15318125 1 Vial

Lentiviral human MTRNR2L1 shRNA (UAS) - Lentiviral human MTRNR2L1 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details