Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pde2a Rabbit Polyclonal Antibody (HRP)

Pde2a Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Pde2, Pde2a2, CGS-PDE

UniProt

Q01062

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Rat

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: CRSQQYPAARPAEPRGQQVFLKPDEPPPQPCADSLQDALLSLGAVIDIAG

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

104kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_001137319

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GnT-VB shRNA Plasmid (h)
sc-94051-SH 20 µg

GnT-VB shRNA Plasmid (h)

Sign In for Pricing
View Details
Recombinant Schistocerca americana Fasciclin-2 (FAS2), partial
MBS1110716 Inquire

Recombinant Schistocerca americana Fasciclin-2 (FAS2), partial

Sign In for Pricing
View Details
Human 14 3 3 protein theta (YWHAQ) ELISA Kit
GTR10366868 96 Well

Human 14 3 3 protein theta (YWHAQ) ELISA Kit

Sign In for Pricing
View Details
Rabbit Monoclonal PPIL2 Antibody (010) [mFluor Violet 450 SE]
NBP2-90281MFV450 0.1 mL

Rabbit Monoclonal PPIL2 Antibody (010) [mFluor Violet 450 SE]

Sign In for Pricing
View Details
Human GNPDA2 Protein Lysate
MBS8412417-01 0.02 mg

Human GNPDA2 Protein Lysate

Sign In for Pricing
View Details
Human GNPDA2 Protein Lysate
MBS8412417-02 5x 0.02 mg

Human GNPDA2 Protein Lysate

Sign In for Pricing
View Details