Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PIM1 Rabbit Polyclonal Antibody (HRP)

PIM1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PIM

UniProt

P11309

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PIM1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_002639

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Plet1 (Placenta-Expressed Transcript 1 Protein, Antigen mAgK114, Plet1) (Biotin)
MBS6458210-01 0.2 mL

Plet1 (Placenta-Expressed Transcript 1 Protein, Antigen mAgK114, Plet1) (Biotin)

Sign In for Pricing
View Details
Plet1 (Placenta-Expressed Transcript 1 Protein, Antigen mAgK114, Plet1) (Biotin)
MBS6458210-02 5x 0.2 mL

Plet1 (Placenta-Expressed Transcript 1 Protein, Antigen mAgK114, Plet1) (Biotin)

Sign In for Pricing
View Details
TRIM28, NT (TRIM28, KAP1, RNF96, TIF1B, Transcription intermediary factor 1-beta, E3 SUMO-protein ligase TRIM28, KRAB-associated protein 1, KRAB-interacting protein 1, Nuclear corepressor KAP-1, RING finger protein 96, Tripartite motif-containing protein
MBS6358256-01 0.2 mL

TRIM28, NT (TRIM28, KAP1, RNF96, TIF1B, Transcription intermediary factor 1-beta, E3 SUMO-protein ligase TRIM28, KRAB-associated protein 1, KRAB-interacting protein 1, Nuclear corepressor KAP-1, RING finger protein 96, Tripartite motif-containing protein

Sign In for Pricing
View Details
TRIM28, NT (TRIM28, KAP1, RNF96, TIF1B, Transcription intermediary factor 1-beta, E3 SUMO-protein ligase TRIM28, KRAB-associated protein 1, KRAB-interacting protein 1, Nuclear corepressor KAP-1, RING finger protein 96, Tripartite motif-containing protein
MBS6358256-02 5x 0.2 mL

TRIM28, NT (TRIM28, KAP1, RNF96, TIF1B, Transcription intermediary factor 1-beta, E3 SUMO-protein ligase TRIM28, KRAB-associated protein 1, KRAB-interacting protein 1, Nuclear corepressor KAP-1, RING finger protein 96, Tripartite motif-containing protein

Sign In for Pricing
View Details
TAS2R44 Peptide
DF10302-BP 1 mg

TAS2R44 Peptide

Sign In for Pricing
View Details
2-amino-N-methylacetamide, hydrochloride
JH689243 1 Each

2-amino-N-methylacetamide, hydrochloride

Sign In for Pricing
View Details