Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPP2R3A Rabbit Polyclonal Antibody (HRP)

PPP2R3A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PR72, PR130, PPP2R3

UniProt

Q06190

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PPP2R3A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SSSVEEKPLSHRNSLDTNLTSMFLQNFSEEDLVTQILEKHKIDNFSSGTD

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

130kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_002709

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MART-1 (Antigen LB39-AA, Antigen SK29-AA, Melanoma antigen recognized by T-cells 1, MLAN-A, MLANA, Melan-A) (BSA & Azide Free) (MaxLight 750)
MBS6236519-01 0.1 mL

MART-1 (Antigen LB39-AA, Antigen SK29-AA, Melanoma antigen recognized by T-cells 1, MLAN-A, MLANA, Melan-A) (BSA & Azide Free) (MaxLight 750)

Sign In for Pricing
View Details
MART-1 (Antigen LB39-AA, Antigen SK29-AA, Melanoma antigen recognized by T-cells 1, MLAN-A, MLANA, Melan-A) (BSA & Azide Free) (MaxLight 750)
MBS6236519-02 5x 0.1 mL

MART-1 (Antigen LB39-AA, Antigen SK29-AA, Melanoma antigen recognized by T-cells 1, MLAN-A, MLANA, Melan-A) (BSA & Azide Free) (MaxLight 750)

Sign In for Pricing
View Details
Ɑ-Propargylacetamido-ω-Squaric Acid Ester Amido PEG
1320000-70-50.1G 1 g

Ɑ-Propargylacetamido-ω-Squaric Acid Ester Amido PEG

Sign In for Pricing
View Details
Ki-67 Rabbit pAb, Pacific Blue conjugated
orb2999779 100 µL

Ki-67 Rabbit pAb, Pacific Blue conjugated

Sign In for Pricing
View Details
Recombinant Oryza sativa subsp. japonica Actin-depolymerizing factor 6 (ADF6)
MBS1471026-01 0.02 mg (E-Coli)

Recombinant Oryza sativa subsp. japonica Actin-depolymerizing factor 6 (ADF6)

Sign In for Pricing
View Details
Recombinant Oryza sativa subsp. japonica Actin-depolymerizing factor 6 (ADF6)
MBS1471026-02 0.1 mg (E-Coli)

Recombinant Oryza sativa subsp. japonica Actin-depolymerizing factor 6 (ADF6)

Sign In for Pricing
View Details