Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRKCB1 Rabbit Polyclonal Antibody (HRP)

PRKCB1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PKCB, PRKCB1, PRKCB2, PKCI (2), PKCbeta, PKC-beta

UniProt

P05771

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PRKCB1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MADPAAGPPPSEGEESTVRFARKGALRQKNVHEVKNHKFTARFFKQPTFC

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

77kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_002729

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nrarp (m) -PR
sc-150061-PR 10 µM - 20 µL

Nrarp (m) -PR

Sign In for Pricing
View Details
LRFN1 Polyclonal Antibody
MBS9234318-01 0.1 mL

LRFN1 Polyclonal Antibody

Sign In for Pricing
View Details
LRFN1 Polyclonal Antibody
MBS9234318-02 5x 0.1 mL

LRFN1 Polyclonal Antibody

Sign In for Pricing
View Details
ELAVL4 (ELAV-like Protein 4, Hu-antigen D, HuD, Paraneoplastic Encephalomyelitis Antigen HuD, HUD, PNEM) (MaxLight 750) discontinued
E2239-15A-ML750 100 µL

ELAVL4 (ELAV-like Protein 4, Hu-antigen D, HuD, Paraneoplastic Encephalomyelitis Antigen HuD, HUD, PNEM) (MaxLight 750) discontinued

Sign In for Pricing
View Details
HSP 70-1 Double Nickase Plasmid (h2)
sc-418088-NIC-2 20 µg

HSP 70-1 Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
Interleukin 10 Receptor Beta (IL10Rb) Antibody
abx173062-01 200 µg

Interleukin 10 Receptor Beta (IL10Rb) Antibody

Sign In for Pricing
View Details