Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRKCB1 Rabbit Polyclonal Antibody (FITC)

PRKCB1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

PKCB, PRKCB1, PRKCB2, PKCI (2), PKCbeta, PKC-beta

UniProt

P05771

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PRKCB1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: CFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKIHTYSSPTFCDHCGS

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

77kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_002729

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LIFR CRISPR All-in-one AAV vector set (with saCas9)(Rat)
26515156 3x 1.0 µg DNA

LIFR CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
Goflikicept Biosimilar - Research Grade
ICH5578-1mg 1 mg

Goflikicept Biosimilar - Research Grade

Sign In for Pricing
View Details
SPE Cartridge, NH2, 40-75μm, 100Å, 500mg/3mL, 50pcs/pk
15011003 1 Each

SPE Cartridge, NH2, 40-75μm, 100Å, 500mg/3mL, 50pcs/pk

Sign In for Pricing
View Details
LSM8 Rabbit pAb
E45R29167N-50 50 µL

LSM8 Rabbit pAb

Sign In for Pricing
View Details
Recombinant Saccharophagus degradans UDP-N-acetylglucosamine 1-carboxyvinyltransferase (murA)
MBS1375568-01 0.02 mg (E-Coli)

Recombinant Saccharophagus degradans UDP-N-acetylglucosamine 1-carboxyvinyltransferase (murA)

Sign In for Pricing
View Details
Recombinant Saccharophagus degradans UDP-N-acetylglucosamine 1-carboxyvinyltransferase (murA)
MBS1375568-02 0.02 mg (Yeast)

Recombinant Saccharophagus degradans UDP-N-acetylglucosamine 1-carboxyvinyltransferase (murA)

Sign In for Pricing
View Details