Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRKCG Rabbit Polyclonal Antibody (FITC)

PRKCG Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

PKCC, PKCG, SCA14, PKCI (3), PKCgamma, PKC-gamma

UniProt

P05129

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PRKCG

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: FVVHRRCHEFVTFECPGAGKGPQTDDPRNKHKFRLHSYSSPTFCDHCGSL

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

78kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

ChIP, WB

NCBI Accession Number

NP_002730

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Aminoadipate Semialdehyde Synthase (AASS)
OM770057 50 μg

Recombinant Aminoadipate Semialdehyde Synthase (AASS)

Sign In for Pricing
View Details
Chrysanthemum Indicum Extract
C03043 5 mg

Chrysanthemum Indicum Extract

Sign In for Pricing
View Details
Lentiviral human TRIM33 sgRNA gene knockout kit - Lentiviral human TRIM33 sgRNA gene knockout kit (25)
GTR15387483 1 Vial

Lentiviral human TRIM33 sgRNA gene knockout kit - Lentiviral human TRIM33 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
SUGT1 (SGT1, Suppressor of G2 allele of SKP1 (S. cerevisiae), SGT1) (MaxLight 490)
252258-ML490 100 µL

SUGT1 (SGT1, Suppressor of G2 allele of SKP1 (S. cerevisiae), SGT1) (MaxLight 490)

Sign In for Pricing
View Details
Cy3-Linked Monoclonal Antibody to C-Peptide (CP)
MBS2106950-01 0.1 mL

Cy3-Linked Monoclonal Antibody to C-Peptide (CP)

Sign In for Pricing
View Details
Cy3-Linked Monoclonal Antibody to C-Peptide (CP)
MBS2106950-02 0.2 mL

Cy3-Linked Monoclonal Antibody to C-Peptide (CP)

Sign In for Pricing
View Details