Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRKCG Rabbit Polyclonal Antibody (HRP)

PRKCG Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PKCC, PKCG, SCA14, PKCI (3), PKCgamma, PKC-gamma

UniProt

P05129

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PRKCG

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: WSFGVLLYEMLAGQPPFDGEDEEELFQAIMEQTVTYPKSLSREAVAICKG

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

78kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_002730

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FABP3/H-FABP Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-41180R-BF647 100 µL

FABP3/H-FABP Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
ZWILCH (Zwilch Kinetochore Protein, Protein Zwilch Homolog, hZwilch, KNTC1AP) (MaxLight 550)
135851-ML550 100 µL

ZWILCH (Zwilch Kinetochore Protein, Protein Zwilch Homolog, hZwilch, KNTC1AP) (MaxLight 550)

Sign In for Pricing
View Details
Recombinant Clostridium botulinum Probable inorganic polyphosphate/ATP-NAD kinase (ppnK)
MBS1246132-01 0.02 mg (E-Coli)

Recombinant Clostridium botulinum Probable inorganic polyphosphate/ATP-NAD kinase (ppnK)

Sign In for Pricing
View Details
Recombinant Clostridium botulinum Probable inorganic polyphosphate/ATP-NAD kinase (ppnK)
MBS1246132-02 0.02 mg (Yeast)

Recombinant Clostridium botulinum Probable inorganic polyphosphate/ATP-NAD kinase (ppnK)

Sign In for Pricing
View Details
Recombinant Clostridium botulinum Probable inorganic polyphosphate/ATP-NAD kinase (ppnK)
MBS1246132-03 0.1 mg (E-Coli)

Recombinant Clostridium botulinum Probable inorganic polyphosphate/ATP-NAD kinase (ppnK)

Sign In for Pricing
View Details
Recombinant Clostridium botulinum Probable inorganic polyphosphate/ATP-NAD kinase (ppnK)
MBS1246132-04 0.1 mg (Yeast)

Recombinant Clostridium botulinum Probable inorganic polyphosphate/ATP-NAD kinase (ppnK)

Sign In for Pricing
View Details