Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRKCI Rabbit Polyclonal Antibody (HRP)

PRKCI Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PKCI, DXS1179E, nPKC-iota

UniProt

P41743

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PRKCI

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TVIPYNPSSHESLDQVGEEKEAMNTRESGKASSSLGLQDFDLLRVIGRGS

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

68kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_002731

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DCAF8L1 (NM_001017930) Human Over-expression Lysate
LC422759 20 µg

DCAF8L1 (NM_001017930) Human Over-expression Lysate

Sign In for Pricing
View Details
Samd3 Mouse Gene Knockout Kit (CRISPR)
KN515274 1 Kit

Samd3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD6 Mouse Monoclonal Antibody [Clone ID: C6/372 + 3F7B5]
AM50243PU-S 100 µg

CD6 Mouse Monoclonal Antibody [Clone ID: C6/372 + 3F7B5]

Sign In for Pricing
View Details
Dishevelled 2 (DVL2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1B12]
TA806832AM 100 µL

Dishevelled 2 (DVL2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1B12]

Sign In for Pricing
View Details
Human KAT2A/GCN5, N-His, C-His Tag
HA210633-01 20 µg

Human KAT2A/GCN5, N-His, C-His Tag

Sign In for Pricing
View Details
Human KAT2A/GCN5, N-His, C-His Tag
HA210633-02 50 µg

Human KAT2A/GCN5, N-His, C-His Tag

Sign In for Pricing
View Details