Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAPK6 Rabbit Polyclonal Antibody (HRP)

MAPK6 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ERK3, PRKM6, p97MAPK, HsT17250

UniProt

Q16659

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MAPK6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QVDPRKYLDGDREKYLEDPAFDTNYSTEPCWQYSDHHENKYCDLECSHTC

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

83kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_002739

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARVCF Protein Lysate (Rat) with C-HA Tag
12484036 100 µg

ARVCF Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
CTRP8 Antibody
C15205-01 50 μL

CTRP8 Antibody

Sign In for Pricing
View Details
CTRP8 Antibody
C15205-02 100 µL

CTRP8 Antibody

Sign In for Pricing
View Details
F3 (Coagulation Factor III (thromboplastin, Tissue Factor), CD142, TF, TFA)
245886 200 µL

F3 (Coagulation Factor III (thromboplastin, Tissue Factor), CD142, TF, TFA)

Sign In for Pricing
View Details
EGLN1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K0662408 1.0 µg DNA

EGLN1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Recombinant Shigella Dysenteriae zapC Protein (aa 1-180)
VAng-Lsx07354-50gEcoli 50 µg (E. coli)

Recombinant Shigella Dysenteriae zapC Protein (aa 1-180)

Sign In for Pricing
View Details