Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAPK13 Rabbit Polyclonal Antibody (Biotin)

MAPK13 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

SAPK4, PRKM13, MAPK 13, MAPK-13, p38delta

UniProt

Q9N272

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MAPK13

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: EMLTGKTLFKGKDYLDQLTQILKVTGVPGTEFVQKLNDKAAKSYIQSLPQ

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_002745

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SHMT1 (Serine Hydroxymethyltransferase, Cytosolic, SHMT, Serine Methylase, Glycine Hydroxymethyltransferase, MGC15229, MGC24556) (APC)
133325-APC 100 µL

SHMT1 (Serine Hydroxymethyltransferase, Cytosolic, SHMT, Serine Methylase, Glycine Hydroxymethyltransferase, MGC15229, MGC24556) (APC)

Sign In for Pricing
View Details
Labeling Tape, 1" x 500" per Roll
LT-1X500CH 3/Box

Labeling Tape, 1" x 500" per Roll

Sign In for Pricing
View Details
Anti-HIF-beta ARNT Antibody
A02263-1 100 µL

Anti-HIF-beta ARNT Antibody

Sign In for Pricing
View Details
Pseudomonas aeruginosa serotype 5c Ab
MBS5317001-01 0.1 mL

Pseudomonas aeruginosa serotype 5c Ab

Sign In for Pricing
View Details
Pseudomonas aeruginosa serotype 5c Ab
MBS5317001-02 5x 0.1 mL

Pseudomonas aeruginosa serotype 5c Ab

Sign In for Pricing
View Details
Recombinant Oryza sativa subsp. japonica Inosine triphosphate pyrophosphatase (Os10g0457500, LOC_Os10g31940)
MBS1289443-01 0.02 mg (E-Coli)

Recombinant Oryza sativa subsp. japonica Inosine triphosphate pyrophosphatase (Os10g0457500, LOC_Os10g31940)

Sign In for Pricing
View Details